PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_807.4
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family WRKY
Protein Properties Length: 187aa    MW: 21636.2 Da    PI: 9.4137
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_807.4genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY103.61.1e-32107165159
                                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                  ldDgy+WrKYGqK+vk+++fprsYY+Ct++gC+vkk+v+rs+ d+++v++tYeg H+h+
  evm.model.supercontig_807.4 107 LDDGYRWRKYGQKTVKNNKFPRSYYKCTYKGCNVKKQVQRSSIDEQIVVTTYEGIHTHS 165
                                  59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.807.3E-3392166IPR003657WRKY domain
SuperFamilySSF1182905.75E-2999166IPR003657WRKY domain
PROSITE profilePS5081129.838102167IPR003657WRKY domain
SMARTSM007743.7E-38107166IPR003657WRKY domain
PfamPF031068.9E-27108164IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 187 aa     Download sequence    Send to blast
MEKYQILFPD SSASSSFPCS LMNMASPHTG YNILHGDDQG MKKMNNITRA DDQDLDAKKT  60
IYDESTSNGG SGDSEGDRVR IVSEKKKKKE SRRHRYAFQT RSQIDILDDG YRWRKYGQKT  120
VKNNKFPRSY YKCTYKGCNV KKQVQRSSID EQIVVTTYEG IHTHSTQKLD ENFEEILRQI  180
HMHTTF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A3e-2997164774Probable WRKY transcription factor 4
2lex_A3e-2997164774Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007038026.13e-57WRKY-type DNA binding protein 1
TrEMBLA0A061G0194e-57A0A061G019_THECC; WRKY-type DNA binding protein 1
STRINGVIT_17s0000g01280.t011e-52(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50928154
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13080.11e-49WRKY DNA-binding protein 75